logo België / Belgique - Site Review Gemeenschap -> bewerkt door mensen voor mensen

donderdag 29 september 2016

Site Review statistics.mak.ac.ug (visit) (Version française)
je score Delen op Facebook  uw resultaat Delen op Twitterof plaats een banner op uw site
Site ReviewHier kunt u uw mening geven over deze site
Meta data 
Domein IP196.43.133.84
 Research and Education Network of Uganda - RENU
Domain Information
Domein LocationUganda - UG , UGA
Regio: 37 , Kampala
Stad: Kampala
Latitude: 0.31559999999999 , Lengtegraad: 32.5656
Metro code: Area Code:
Domein locatie op de kaart:
Domein Mode statistics.mak.ac.ug

Details - Domein Mode statistics.mak.ac.ug
Archive site
Zie je hoe de pagina eruit zag in het verledenLink naar het archief op de website
DMOZ categorieën 
 Link naar het Open Directory Project - door mensen bewerkte
 Toon Variations
Verberg variaties
recente wereldwijde reviews van alle andere plaatsenHier is een korte lijst van andere sites onder herziening
Bijgewerkt sites: 
pilba.org -
discoverpawleysisland.com -
elowcountry.com -
waccamawfamilypractice.familydoctors.net -
prsrehabservices.com -
strandspineinstitute.com -
lowcountryvisioncare.com -
davidgrabeman.com -
waccamawdental.com -
coastalcarolinasoccercamp.com -
pawleysislandoutdoors.com -
barrierislandguide.com -
traditiongolfclub.com -
truebluegolf.com -
fishclub.com -
dressergolf.com -
litchfieldbeachespoa.com -
litchfieldretreat.com -
pawleysislandbridgeclub.com -
wnccwebsite.com -
kiwanispawleys-island.org -
litchfieldbythesea.com -
e-district.org -
allsaintspawleys.org -
pbocchurch.com -
saintpaulsumc.com -
picc.ws -
call2disciple.com -
pawleysislandpresby.com -
litchfieldinn.com -


Plaats de volgende HTML code op uw site een banner te komen met de geschatte waarde van uw website

EWSITE.BE 2003-2012

De rechten op genoemde producten, materialen, objecten, bedrijven, gekoppeld video's / afbeeldingen, handelsmerken of andere wijze gekoppeld webcontent het eigendom van hun respectieve eigenaars en bronnen. Deze site is niet verantwoordelijk voor en vertegenwoordigt niet over de juistheid of de betrouwbaarheid van enige mening, advies, verklaring, aanbeveling of andere informatie op een pagina geplaatst. Eventuele afhankelijkheid door u op een dergelijk advies , Het advies, verklaring, aanbeveling of andere informatie op eigen risico. We willen niet te verzekeren en bieden geen garantie van de betrouwbaarheid van de meegeleverde content
Wij steunen de Vrijheid van de pers -. de vrijheid van communicatie en expressie door middel van voertuigen, waaronder diverse elektronische me studies en gepubliceerde materiaal. Hoewel een dergelijke vrijheid betekent meestal dat de afwezigheid van interferentie van een overreaching de overheid, het behoud ervan gezocht door de koe constitutionele of andere wettelijke bescherming .

Terms and Conditions | Impressum / Imprint | Privacy Policy | Contact| Rapporteer een overtreding| laatste| Nieuwste Zwitserse| Nieuwste Nederland| Wat is mijn IP adres?
Creative Commons Licence
This work is licenced under a Creative Commons Licence.
0.3710 sec.

CANADA - België / Belgique / Belgien | Bulgaria | Deutschland | España | France | Malaysia | México | Nederland | Norge | United Kingdom | India | Indonesia | தமிழ் | Suomi | South Korea | România | Russia | Danmark | Brazil / Portugal | Vietnam | Schweiz / Suisse / Svizzera | Sverige / Sweden | తెలుగు | Italy / Italia | Arabic | Turkey